PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G108000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 311aa    MW: 34924.4 Da    PI: 7.0471
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G108000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.1e-53251531128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yL+++v+g++ ++  +i+evd+yk++PwdLp+++  +++ewyfF++rd+ky++g+r+nra+ sgyWkatg dk+
  Brast01G108000.1.p  25 LPPGFRFHPTDEELVVHYLCRRVAGQPQPV-PIIAEVDLYKFNPWDLPERALFGRREWYFFTPRDRKYPNGSRPNRAAGSGYWKATGADKP 114
                         79*************************999.88***************87778999*********************************** PP

                 NAM  92 vlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v  k  +g++vg+kk Lvfy+grap+g+ktdW+mheyrl
  Brast01G108000.1.p 115 VSPKgsGGRTVGIKKALVFYSGRAPRGVKTDWIMHEYRL 153
                         *999888999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6421180IPR003441NAC domain
PROSITE profilePS5100562.42925180IPR003441NAC domain
PfamPF023651.3E-2726153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAMVKVEPTA AEGSGRRDAE AELNLPPGFR FHPTDEELVV HYLCRRVAGQ PQPVPIIAEV  60
DLYKFNPWDL PERALFGRRE WYFFTPRDRK YPNGSRPNRA AGSGYWKATG ADKPVSPKGS  120
GGRTVGIKKA LVFYSGRAPR GVKTDWIMHE YRLAEADRSP VAKKGSQKLD EWVMCRLYNK  180
KNNWEKVKVE QDMAAVQRQN GEVMDAPTAT DTMSDSFQTH DSEIDNASGL QLHGFRDMAQ  240
GQARDGIVTV KEDNDWFTDL NLDELQACYM NMQGQMVNPA VAVPGLDGSG YLQSMNSSQM  300
RMWQTILPPF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-96171867174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ9853290.0GQ985329.1 Triticum aestivum transcription factor TaNAC4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564478.10.0PREDICTED: NAC domain-containing protein 68-like
SwissprotQ52QH41e-168NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLI1HSS70.0I1HSS7_BRADI; Uncharacterized protein
STRINGBRADI2G53260.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63790.12e-83NAC domain containing protein 102